PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G0812
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 1083aa    MW: 119713 Da    PI: 8.5518
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G0812genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.14e-41151228178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqv++C++dls+ak+yhrrhkvCe+hska+++lv++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  Gh_A01G0812 151 MCQVDNCKEDLSNAKDYHRRHKVCEIHSKATKALVEKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 228
                  6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.3E-34146213IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.052149226IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-37150230IPR004333Transcription factor, SBP-box
PfamPF031105.0E-30152225IPR004333Transcription factor, SBP-box
CDDcd002047.24E-7831973No hitNo description
Gene3DG3DSA:1.25.40.201.2E-4831980IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484031.28E-6831997IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1083 aa     Download sequence    Send to blast
MEDAGAQVAP PLYIHQALAS RFCDTPSLPR KRDLSYQASD FLYQNPSQQR VANPRDNWNP  60
KQWEWDAVRF IAKPLNTEIL QTGTATAEQR KKGHVNGNEN SITSKKATAA NDDDERLQLN  120
LGGGLNSVEE PVSRPNKKVR GGSPGSTSYP MCQVDNCKED LSNAKDYHRR HKVCEIHSKA  180
TKALVEKQMQ RFCQQCSRFH PLSEFDEGKR SCRRRLAGHN RRRRKTQPED VTSRLLLPAN  240
RDNAGNGSLD IVSLLTLLAR TQGKKFFLND INPSPVPNRD QLLQILSKIN SLPLPMDLAA  300
KLPNVGVLNR KSQEQPSLGN QNQLNGKNTS SPSTVDLLAA LSATLTSSSS DALAMLSQRS  360
SQSSDSQKTK SICPDNVAAS SSLNRAPLEF TSFGGERSST SYQSPVEDSE CQIQETRANL  420
PLQLFSSSPE DDSPPKLASS RKYFSSDSSN PMEERSPSSS PVVQKFFPMH STPEAVKYEK  480
VPIGRHANTN AETSRAHGSI IPLELFSGSK RGTGRGSFQH FPSQAGYTSS SGSDHSPSSL  540
NSDAQQDRTG RIIFKLFDKD PSHFPGTLRT QIYNWLSNSP SEMESYIRPG CVVLSVYVSM  600
PAPAWEQLEG NLLQYVNCLL QDSDSDFWRK ARFLVHTGNR QLASHKDGKI HLCKSWLSSS  660
SPELISVSPL AVVSGQETSL LVRGRNLTNP GTEIHCAYMG GYSSMQINGS TYKGASYDEV  720
NMGSFKIQVP SPKALGRCFI EVENGFKGNS FPIIIADAAI CKELRLLESE LDTEVKASDI  780
ISEEHAYDSH RPRSREEVLH FLNELGWLFQ RSTAPLPKSS DHSLRRFKFL LMFSVESDYC  840
ALVKVLLDML VESNLDMNDL SKDSLAMLSE IQLLTRAVKR RCRKMADLLI HYSISSNDGN  900
SKKYIFPPNL EGAGGISPLH LAACTSGSDD MVDVLTNDPQ EIGLTCWSSL LDANGQSPYA  960
YAMMRNNHSY NKLVAGKYAD RRNGQVSLTI GVEDQHSGVS AVQLNKISLR FKQDRSSCAK  1020
CAVVATRSNN RFPGSQGLLQ RPYVHSMLAI AAVCVCVCLF LRGSPNIGRV SPFKWENLDF  1080
GTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-32142225184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1875880RAVKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.90830.0boll| ovule| root
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223220.0KJ622322.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL14) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012463926.10.0PREDICTED: squamosa promoter-binding-like protein 14
RefseqXP_012463917.10.0PREDICTED: squamosa promoter-binding-like protein 14
RefseqXP_012463909.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A0D2R4560.0A0A0D2R456_G
STRINGVIT_18s0122g00380.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39992554
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14